Monoclonal Antibody to Human IgE |
|
MBS465043-01mg |
MyBiosource |
0.1mg |
EUR 360 |
Ige Monoclonal Laboratories manufactures the monoclonal antibody to ige for allergies reagents distributed by Genprice. The Monoclonal Antibody To Ige For Allergies reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact ige monoclonal. Other Monoclonal products are available in stock. Specificity: Monoclonal Category: Antibody Group: To Ige
Monoclonal Antibody to Human Immunoglobulin epsilon (hu-IgE) |
|
MyBiosource |
1mg |
EUR 305 |
Food Allergies IgG - Allerquant 90G ELISA Kit |
|
Creative Diagnostics |
288T |
EUR 1107.6 |
|
Description: The 90 Food IgG Elisa Test is for measuring the relative amount of food-specific IgG antibody in human serum. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 423.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 480 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594. |
To Ige information
APC-Linked Monoclonal Antibody to Immunoglobulin E (IgE) |
|
MBS2107321-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
Cy3-Linked Monoclonal Antibody to Immunoglobulin E (IgE) |
|
MBS2107323-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
HRP-Linked Monoclonal Antibody to Immunoglobulin E (IgE) |
|
MBS2107329-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
FITC-Linked Monoclonal Antibody to Immunoglobulin E (IgE) |
|
MBS2107327-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
Botin-Linked Monoclonal Antibody to Immunoglobulin E (IgE) |
|
MBS2107325-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
APC/Cy7 Linked Monoclonal Antibody to Immunoglobulin E (IgE) |
|
MBS2107317-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
Mouse Monoclonal anti-Human IgE Antibody |
|
xAP-0403 |
Angio Proteomie |
100ug |
EUR 280 |
Anti-Human IgE, Rabbit Monoclonal Antibody |
|
A1800-50 |
Biovision |
each |
EUR 392.4 |
