Monoclonal Antibody To Ige For Allergies

Monoclonal Antibody to Human IgE

MBS465043-01mg 0.1mg
EUR 360

Ige Monoclonal Laboratories manufactures the monoclonal antibody to ige for allergies reagents distributed by Genprice. The Monoclonal Antibody To Ige For Allergies reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact ige monoclonal. Other Monoclonal products are available in stock. Specificity: Monoclonal Category: Antibody Group: To Ige

Monoclonal Antibody to Human Immunoglobulin epsilon (hu-IgE)

1mg
EUR 305

PE-Linked Monoclonal Antibody to Immunoglobulin E (IgE)

INQUIRE Ask for price

APC-Linked Monoclonal Antibody to Immunoglobulin E (IgE)

INQUIRE Ask for price

Cy3-Linked Monoclonal Antibody to Immunoglobulin E (IgE)

INQUIRE Ask for price

Botin-Linked Monoclonal Antibody to Immunoglobulin E (IgE)

INQUIRE Ask for price

FITC-Linked Monoclonal Antibody to Immunoglobulin E (IgE)

INQUIRE Ask for price

HRP-Linked Monoclonal Antibody to Immunoglobulin E (IgE)

INQUIRE Ask for price

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

To Ige information

Monoclonal Anti-human IgE antibody.

TMI021-0.25MG 0.25mg
EUR 169
Description: Specific to human IgE, no cross reaction with IgA, IgG, and IgM. This antibody can be paired with TMI022.

Monoclonal Anti-human IgE antibody.

TMI021-1MG 1mg
EUR 569
Description: Specific to human IgE, no cross reaction with IgA, IgG, and IgM. This antibody can be paired with TMI022.

Monoclonal Anti-human IgE antibody.

TMI022-0.25MG 0.25mg
EUR 169
Description: Specific to human IgE, no cross reaction with IgA, IgG, and IgM. This antibody can be paired with TMI021.

Monoclonal Anti-human IgE antibody.

TMI022-1MG 1mg
EUR 569
Description: Specific to human IgE, no cross reaction with IgA, IgG, and IgM. This antibody can be paired with TMI021.

Mouse Anti-Peanut allergen Ara H1 monoclonal antibody, clone Arah1D

HMABPY116D 100 µg; 1 mg Ask for price
Description: Mouse

Mouse Anti-Peanut allergen Ara H1 monoclonal antibody, clone Arah1D

HMABPY116D-100ug 100 ug
EUR 639.6

Mouse Anti-Peanut allergen Ara H1 monoclonal antibody, clone Arah1D

HMABPY116D-1mg 1 mg
EUR 1575.6

Mouse Anti-Peanut allergen Ara H2 monoclonal antibody, clone Arah2D

HMABPY117D 100 µg; 1 mg Ask for price
Description: Mouse

Mouse Anti-Peanut allergen Ara H2 monoclonal antibody, clone Arah2D

HMABPY117D-100ug 100 ug
EUR 639.6

Mouse Anti-Peanut allergen Ara H2 monoclonal antibody, clone Arah2D

HMABPY117D-1mg 1 mg
EUR 1575.6

PE-Linked Monoclonal Antibody to Immunoglobulin E (IgE)

MBS2107319-INQUIRE INQUIRE Ask for price

APC-Linked Monoclonal Antibody to Immunoglobulin E (IgE)

MBS2107321-INQUIRE INQUIRE Ask for price

Cy3-Linked Monoclonal Antibody to Immunoglobulin E (IgE)

MBS2107323-INQUIRE INQUIRE Ask for price

HRP-Linked Monoclonal Antibody to Immunoglobulin E (IgE)

MBS2107329-INQUIRE INQUIRE Ask for price

FITC-Linked Monoclonal Antibody to Immunoglobulin E (IgE)

MBS2107327-INQUIRE INQUIRE Ask for price

Botin-Linked Monoclonal Antibody to Immunoglobulin E (IgE)

MBS2107325-INQUIRE INQUIRE Ask for price

Immunoglobulin E (IgE) Monoclonal Antibody

CAU30524-100ul 100ul
EUR 267.8

Immunoglobulin E (IgE) Monoclonal Antibody

CAU30524-200ul 200ul
EUR 334.3

Mouse Anti Dog Ige Monoclonal Antibody

DMABT-48838MD 0.25 mg
EUR 567
Description: Mouse

Mouse Anti Dog Ige Monoclonal Antibody

DMABT-51918MD 0.25 mg
EUR 567
Description: Mouse

Mouse Anti Rat Ige Monoclonal Antibody

CABT-49905MR 0.25 mg
EUR 502.32
Description: Mouse

Rat Anti Mouse Ige Monoclonal Antibody

CABT-54522RM 0.5 mg
EUR 659.4
Description: Rat

Mouse Anti Human Ige Monoclonal Antibody

CABT-48840MH 1 mg
EUR 567
Description: Mouse

Mouse Anti Human Ige Monoclonal Antibody

CABT-48844MH 0.2 mg
EUR 579.6
Description: Mouse

Mouse Anti Human Ige Monoclonal Antibody

CABT-48845MH 0.5 mg
EUR 642.6
Description: Mouse

APC/Cy7 Linked Monoclonal Antibody to Immunoglobulin E (IgE)

MBS2107317-INQUIRE INQUIRE Ask for price

Mouse Monoclonal anti-Human IgE Antibody

xAP-0403 100ug
EUR 280

Anti-Human IgE, Rabbit Monoclonal Antibody

A1800-50 each
EUR 392.4