Monoclonal Antibody to Human IgE |
|
MBS465043-01mg |
MyBiosource |
0.1mg |
EUR 360 |
Ige Monoclonal Laboratories manufactures the monoclonal antibody to ige for asthma reagents distributed by Genprice. The Monoclonal Antibody To Ige For Asthma reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact ige monoclonal. Other Monoclonal products are available in stock. Specificity: Monoclonal Category: Antibody Group: To Ige
PE-Linked Monoclonal Antibody to Immunoglobulin E (IgE) |
|
MyBiosource |
INQUIRE |
Ask for price |
APC-Linked Monoclonal Antibody to Immunoglobulin E (IgE) |
|
MyBiosource |
INQUIRE |
Ask for price |
Cy3-Linked Monoclonal Antibody to Immunoglobulin E (IgE) |
|
MyBiosource |
INQUIRE |
Ask for price |
Botin-Linked Monoclonal Antibody to Immunoglobulin E (IgE) |
|
MyBiosource |
INQUIRE |
Ask for price |
FITC-Linked Monoclonal Antibody to Immunoglobulin E (IgE) |
|
MyBiosource |
INQUIRE |
Ask for price |
HRP-Linked Monoclonal Antibody to Immunoglobulin E (IgE) |
|
MyBiosource |
INQUIRE |
Ask for price |
Human Asthma PB |
|
AcceGen |
1 pack |
Ask for price |
|
|
|
Description: <div Asthma is a condition that causes airways to swell and narrow. This creates problems with breathing and can result in coughing, wheezing, shortness of breath, extra mucous production. It can result from an allergic reaction and other hypersensitivities.</div<div <div Specimens available from both adults and pediatric donors. Included types: acute, chronic, severe, bronchial, exercise-induced, allergy-induced, controlled, intermittent, intrinsic, epostic.</div</div<br / |
cDNA - Asthma: Lung |
|
Biochain |
40 reactions |
EUR 726.6 |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 423.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 480 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
To Ige information
HRP-Linked Monoclonal Antibody to Immunoglobulin E (IgE) |
|
MBS2107329-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
FITC-Linked Monoclonal Antibody to Immunoglobulin E (IgE) |
|
MBS2107327-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
Botin-Linked Monoclonal Antibody to Immunoglobulin E (IgE) |
|
MBS2107325-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
Human Asthma PB |
|
ABC-TC4295 |
AcceGen |
1 pack |
Ask for price |
|
|
|
Description: <div Asthma is a condition that causes airways to swell and narrow. This creates problems with breathing and can result in coughing, wheezing, shortness of breath, extra mucous production. It can result from an allergic reaction and other hypersensitivities.</div<div <div Specimens available from both adults and pediatric donors. Included types: acute, chronic, severe, bronchial, exercise-induced, allergy-induced, controlled, intermittent, intrinsic, epostic.</div</div<br / |
Mouse Anti Dog Ige Monoclonal Antibody |
|
DMABT-48838MD |
Creative Diagnostics |
0.25 mg |
EUR 567 |
|
|
|
Description: Mouse |
Mouse Anti Dog Ige Monoclonal Antibody |
|
DMABT-51918MD |
Creative Diagnostics |
0.25 mg |
EUR 567 |
|
|
|
Description: Mouse |
Mouse Anti Rat Ige Monoclonal Antibody |
|
CABT-49905MR |
Creative Diagnostics |
0.25 mg |
EUR 502.32 |
|
|
|
Description: Mouse |
Rat Anti Mouse Ige Monoclonal Antibody |
|
CABT-54522RM |
Creative Diagnostics |
0.5 mg |
EUR 659.4 |
|
|
|
Description: Rat |
cDNA - Asthma: Lung |
|
C1236152Ld-1 |
Biochain |
40 reactions |
EUR 726.6 |
Mouse Anti Human Ige Monoclonal Antibody |
|
CABT-48840MH |
Creative Diagnostics |
1 mg |
EUR 567 |
|
|
|
Description: Mouse |
Mouse Anti Human Ige Monoclonal Antibody |
|
CABT-48844MH |
Creative Diagnostics |
0.2 mg |
EUR 579.6 |
|
|
|
Description: Mouse |
Mouse Anti Human Ige Monoclonal Antibody |
|
CABT-48845MH |
Creative Diagnostics |
0.5 mg |
EUR 642.6 |
|
|
|
Description: Mouse |
APC/Cy7 Linked Monoclonal Antibody to Immunoglobulin E (IgE) |
|
MBS2107317-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
Mouse Monoclonal anti-Human IgE Antibody |
|
xAP-0403 |
Angio Proteomie |
100ug |
EUR 280 |
Anti-Human IgE, Rabbit Monoclonal Antibody |
|
A1800-50 |
Biovision |
each |
EUR 392.4 |
Mouse Anti-Canine IgE Monoclonal Antibody |
|
VD12N25 |
BioVenic |
1 Each |
Ask for price |
Mouse Anti-Porcine IgE Monoclonal Antibody |
|
VD11N347 |
BioVenic |
1 Each |
Ask for price |
Immunoglobulin E (IgE) Monoclonal Antibody (Pig) |
|
4-MAA545Po21 |
Cloud-Clone |
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
|
- 20ul
- 100ul
- 200ul
- 1ml
- 10ml
|
|
|
|
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE) |
Mouse Anti Rat Ige Monoclonal Antibody,HRP |
|
CABT-49904MR |
Creative Diagnostics |
0.5 mg |
EUR 924 |
|
|
|
Description: Mouse |
Human IgE Recombinant Mouse monoclonal Antibody |
|
HA601527F |
HUABIO |
100 Tests |
Ask for price |
Mouse Anti Rat Ige Monoclonal Antibody,FITC |
|
CABT-49903MR |
Creative Diagnostics |
0.5 mg |
EUR 546 |
|
|
|
Description: Mouse |
Mouse Anti Human Ige Monoclonal Antibody,HRP |
|
CABT-48842MH |
Creative Diagnostics |
0.1 mg |
EUR 540.54 |
|
|
|
Description: Mouse |
Mouse Anti Dog Ige Monoclonal Antibody,Biotin |
|
DMABT-48837MD |
Creative Diagnostics |
0.25 mg |
EUR 667.8 |
|
|
|
Description: Mouse |
Mouse Anti Rat Ige Monoclonal Antibody,Biotin |
|
CABT-49902MR |
Creative Diagnostics |
0.5 mg |
EUR 546 |
|
|
|
Description: Mouse |
Immunoglobulin E (IgE) Monoclonal Antibody (Pig), PE |
|
4-MAA545Po21-PE |
Cloud-Clone |
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
|
- 20ul
- 100ul
- 200ul
- 1ml
- 10ml
|
|
|
|
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with PE. |