Monoclonal Antibody To Ige For Asthma

cDNA - Asthma: Lung

C1236152Ld-1 40 reactions
EUR 899

Ige Monoclonal Laboratories manufactures the monoclonal antibody to ige for asthma reagents distributed by Genprice. The Monoclonal Antibody To Ige For Asthma reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact ige monoclonal. Other Monoclonal products are available in stock. Specificity: Monoclonal Category: Antibody Group: To Ige

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

To Ige information

Rat Anti Mouse Ige Heavy Chain Monoclonal Antibody

CABT-54633RM 0.25 mg
EUR 795.6

Anti-Human IgE Rabbit Monoclonal Antibody, Clone#RM122

M10533 100ug
EUR 492
Description: Anti-Human IgE Rabbit Monoclonal Antibody, Clone#RM122 tested in ICC, IHC, FC, ELISA, reactive to Human

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), Biotinylated

4-MAA545Po21-Biotin
  • EUR 399.60
  • EUR 3331.20
  • EUR 967.20
  • EUR 494.40
  • EUR 273.60
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with Biotin.

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), APC-Cy7

4-MAA545Po21-APC-Cy7
  • EUR 757.20
  • EUR 8752.80
  • EUR 2305.20
  • EUR 1015.20
  • EUR 412.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with APC-Cy7.

Rat Anti Mouse Ige Heavy Chain Monoclonal Antibody,HRP

CABT-54632RM 0.5 mg
EUR 1070.4

Rat Anti Mouse Ige Heavy Chain Monoclonal Antibody,FITC

CABT-54631RM 0.5 mg
EUR 889.2

Frozen Tissue Section - Asthma: Lung

T1236152Ld-1 5 slides
EUR 475

Rat Anti Mouse Ige Heavy Chain Monoclonal Antibody,Biotin

CABT-54630RM 0.5 mg
EUR 889.2

Paraffin Tissue Section - Asthma: Lung

T2236152Ld-1 5 slides
EUR 475

Mouse IgE Monoclonal Antibody, Isotype Control, Clone 2A101A12

7129 1 mg/ml x 0.5 ml
EUR 580.26
Description: Mouse IgE Monoclonal Antibody

Mouse Anti-Ovalbumin IgE Monoclonal Antibody, Clone E-C1

7091 1 mg/ml x 0.1 ml
EUR 406.26
Description: Mouse Anti-Ovalbumin IgE Monoclonal Antibody

Mouse Anti-Ovalbumin IgE Monoclonal Antibody, Clone E-G5

7092 1 mg/ml x 0.1 ml
EUR 406.26
Description: Mouse Anti-Ovalbumin IgE Monoclonal Antibody

Monoclonal Mouse Anti-Human IgE Antibody, Clone: 1497CT272.23.66

AMM02534G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human Mouse Anti-Human IgE. The antibodies are raised in Mouse and are from clone 1497CT272.23.66. This antibody is applicable in E

Monoclonal Mouse Anti-Human IgE Antibody, Clone: 1497CT744.79.17

AMM02535G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human Mouse Anti-Human IgE. The antibodies are raised in Mouse and are from clone 1497CT744.79.17. This antibody is applicable in E

Monoclonal Anti-Horse IgE, unlabeled

80872-U 100 ul
EUR 416.4

anti-Fc? RI? (human IgE receptor) antibody, monoclonal (CRA1)

72-001 100ug
EUR 496.8
Description: The anti-Fc? RI? (human IgE receptor) antibody, monoclonal (CRA1) is available in Europe and for worldwide shipping via Gentaur.

anti-Fc? RI? ?human IgE receptor) antibody, monoclonal (CRA2)

72-005 100ug Ask for price
Description: The anti-Fc? RI? ?human IgE receptor) antibody, monoclonal (CRA2) is available in Europe and for worldwide shipping via Gentaur.