Monoclonal Antibody To Ige For Asthma

Monoclonal Antibody to Human IgE

MBS465043-01mg 0.1mg
EUR 360

Ige Monoclonal Laboratories manufactures the monoclonal antibody to ige for asthma reagents distributed by Genprice. The Monoclonal Antibody To Ige For Asthma reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact ige monoclonal. Other Monoclonal products are available in stock. Specificity: Monoclonal Category: Antibody Group: To Ige

HRP-Linked Monoclonal Antibody to Immunoglobulin E (IgE)

INQUIRE Ask for price

Monoclonal Antibody to Human Immunoglobulin epsilon (hu-IgE)

1mg
EUR 305

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

To Ige information

Mouse Anti Human Ige Monoclonal Antibody

CABT-48845MH 0.5 mg
EUR 1033.2

APC/Cy7 Linked Monoclonal Antibody to Immunoglobulin E (IgE)

MBS2107317-INQUIRE INQUIRE Ask for price

Mouse Monoclonal anti-Human IgE Antibody

xAP-0403 100ug
EUR 280

Anti-Human IgE, Rabbit Monoclonal Antibody

A1800-50 each
EUR 392.4

Immunoglobulin E (IgE) Monoclonal Antibody (Pig)

4-MAA545Po21
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE)

Mouse Anti Rat Ige Monoclonal Antibody,HRP

CABT-49904MR 0.5 mg
EUR 1450.8

Mouse Anti Rat Ige Monoclonal Antibody,FITC

CABT-49903MR 0.5 mg
EUR 889.2

Mouse Anti Human Ige Monoclonal Antibody,HRP

CABT-48842MH 0.1 mg
EUR 696

Human Asthma PB

ABC-TC4295 1 pack Ask for price
Description: <div Asthma is a condition that causes airways to swell and narrow. This creates problems with breathing and can result in coughing, wheezing, shortness of breath, extra mucous production. It can result from an allergic reaction and other hypersensitivities.</div<div <div Specimens available from both adults and pediatric donors. Included types: acute, chronic, severe, bronchial, exercise-induced, allergy-induced, controlled, intermittent, intrinsic, epostic.</div</div<br /

Mouse Anti Dog Ige Monoclonal Antibody,Biotin

DMABT-48837MD 0.25 mg
EUR 1070.4

Mouse Anti Rat Ige Monoclonal Antibody,Biotin

CABT-49902MR 0.5 mg
EUR 889.2

cDNA - Asthma: Lung

C1236152Ld-1 40 reactions
EUR 989

Human IgE mouse monoclonal antibody, clone 4H10

1E4-4H10 1 mg Ask for price

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), PE

4-MAA545Po21-PE
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with PE.

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), APC

4-MAA545Po21-APC
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with APC.

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), Cy3

4-MAA545Po21-Cy3
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with Cy3.

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), HRP

4-MAA545Po21-HRP
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with HRP.